PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28677.m000055
Common NameLOC8258926, RCOM_0307540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 567aa    MW: 62550.4 Da    PI: 4.9504
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28677.m000055genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.52e-1402005621374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    lv++Ll+cAea+++++++la+alL+++  la++++++m+++a+yf+eALa+r+++    +y    p+e+ + + s++l +   f+e++P+lkf+h+
  28677.m000055 200 LVHTLLACAEAIQQDNFKLAEALLKHIGLLAASQASSMRKVATYFAEALARRIYK----IY----PQESLDPSYSDTLEM--HFYETCPYLKFAHF 285
                    689****************************************************....44....444443445555555..5************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    taNqaIlea+ +++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s+++++l+++g++La++A+++gv+fef+ +va++l+dl++e
  28677.m000055 286 TANQAILEAFGTANRVHVIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQSNNTDALQQVGWKLAQLADTIGVEFEFRGFVANSLADLQPE 381
                    ************************************************************************************************ PP

           GRAS 193 eLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +L+++p   E++aVn+v++lhrll++++ +e+    vL+ +k ++Pk+v+vveqea+hn++ Fl+rf+eal+yys+lfdsle +  +  +++ +++
  28677.m000055 382 MLDLRPpdVETVAVNSVFELHRLLARPGGMEK----VLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSSLFDSLEGSGLNVPSQDLVMS 473
                    ******999***********************....*********************************************888555569999*** PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    + +lgr+i+nvvacega+r+erhe+l +Wr r+e+aGF  v+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  28677.m000055 474 ELYLGRQICNVVACEGAHRVERHESLPHWRTRFESAGFDRVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWQ 562
                    ****************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120413.5E-3640105IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.3E-3840112No hitNo description
PROSITE profilePS5098568.393174541IPR005202Transcription factor GRAS
PfamPF035146.8E-138200562IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MKREHQESKG DSSSSCSAMA KGKLWQEEEE QQQQDGGGMD ELLAVLGYKV RSSDMAEVAQ  60
KLEQLEMVMG IAQEDGISHL SDTVHYNPSD LSGWVQSMLS ELNNPLDTIQ NQQDSSSVIS  120
FGNSQSGIFN DDSEYDLRAI PGVAAYPPQP ESSDSNNNSS SRKRMKTSTL ANSDSTIPTN  180
LSEPNRPMVL IDSQETGVRL VHTLLACAEA IQQDNFKLAE ALLKHIGLLA ASQASSMRKV  240
ATYFAEALAR RIYKIYPQES LDPSYSDTLE MHFYETCPYL KFAHFTANQA ILEAFGTANR  300
VHVIDFGLKQ GMQWPALMQA LALRPGGPPA FRLTGIGPPQ SNNTDALQQV GWKLAQLADT  360
IGVEFEFRGF VANSLADLQP EMLDLRPPDV ETVAVNSVFE LHRLLARPGG MEKVLSSIKA  420
MKPKIVTVVE QEASHNGPVF LDRFTEALHY YSSLFDSLEG SGLNVPSQDL VMSELYLGRQ  480
ICNVVACEGA HRVERHESLP HWRTRFESAG FDRVHLGSNA FKQASMLLAL FAGGDGYRVE  540
ENNGCLMLGW HTRPLIATSA WQLSDSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-562005624375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534030.10.0PREDICTED: DELLA protein GAI
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLB9T7110.0B9T711_RICCO; DELLA protein GAI, putative
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2